PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G19330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 181aa    MW: 20225.5 Da    PI: 9.6039
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G19330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.71.1e-072571347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     +W++ Ed+ +  a   ++ +   +W+ +a++++ gR++ ++ ++++ +
  ORUFI05G19330.1 25 PWSKAEDKVFESALVAFPEHthnRWAIVASRLP-GRSAHEVWEHYRVL 71
                     8***************9999999**********.***********976 PP

2Myb_DNA-binding45.32e-14113157347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qk+
  ORUFI05G19330.1 113 PWTEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKF 157
                      8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.5E-72274IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-62471IPR009057Homeodomain-like
SuperFamilySSF466896.21E-122479IPR009057Homeodomain-like
PfamPF002491.9E-62571IPR001005SANT/Myb domain
CDDcd001677.30E-62572No hitNo description
PROSITE profilePS500906.8992572IPR017877Myb-like domain
PROSITE profilePS5129419.617106162IPR017930Myb domain
SuperFamilySSF466895.18E-18108162IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-16110161IPR006447Myb domain, plants
SMARTSM007172.8E-10110160IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-11112153IPR009057Homeodomain-like
CDDcd001671.80E-10113158No hitNo description
PfamPF002498.0E-11113156IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MAFYGGEMGG SSSSWVAPLV PSSRPWSKAE DKVFESALVA FPEHTHNRWA IVASRLPGRS  60
AHEVWEHYRV LVDDVDLIER GMVASPGCWD DGAGRGGAQG ASRGGDERRR GVPWTEEEHR  120
LFLEGLEKYG RGDWRNISRW SVKTRTPTQV ASHAQKFFIR QANAGNRSDS KRKSIHDIIA  180
P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A9e-142292777RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1376110.0AC137611.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0020H14, complete sequence.
GenBankAC1474620.0AC147462.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone B1110B01, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638220.11e-109PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-50DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0E0PN441e-131A0A0E0PN44_ORYRU; Uncharacterized protein
TrEMBLA2Y5541e-131A2Y554_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA017965-PA1e-130(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-45MYB family protein